Loading...
Statistics
Advertisement

Aeet - Estatutos
www.aeet.info/

Aeet.info

Advertisement
Conversion Technology Metas Server
Aeet.info is hosted in Spain / Huelva . Aeet.info uses HTTPS protocol. Number of used technologies: 3. First technologies: CSS, Html, Php, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Microsoft-IIS/7.5.

Technologies in use by Aeet.info

Technology

Number of occurences: 3
  • CSS
  • Html
  • Php

Advertisement

Server Type

  • Microsoft-IIS/7.5

Powered by

  • ASP.NET

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Aeet.info

SSL certificate

    • name: /C=US/ST=Virginia/L=Herndon/O=Parallels, Inc./OU=Parallels Panel/CN=Parallels Panel/emailAddress=info@parallels.com
    • subject:
      • C: US
      • ST: Virginia
      • L: Herndon
      • O: Parallels, Inc.
      • OU: Parallels Panel
      • CN: Parallels Panel
      • emailAddress: info@parallels.com
    • hash: 8bc540cd
    • issuer:
      • C: US
      • ST: Virginia
      • L: Herndon
      • O: Parallels, Inc.
      • OU: Parallels Panel
      • CN: Parallels Panel
      • emailAddress: info@parallels.com
    • version: 2
    • serialNumber: 8518406
    • validFrom: 120705124607Z
    • validTo: 130705124607Z
    • validFrom_time_t: 1341492367
    • validTo_time_t: 1373028367
    • extensions:
      • subjectKeyIdentifier: 35:E3:F6:BA:02:C6:CA:33:1D:F2:F3:23:91:C2:2F:CE:CD:56:04:DE
      • authorityKeyIdentifier: keyid:35:E3:F6:BA:02:C6:CA:33:1D:F2:F3:23:91:C2:2F:CE:CD:56:04:DE DirName:/C=US/ST=Virginia/L=Herndon/O=Parallels, Inc./OU=Parallels Panel/CN=Parallels Panel/emailAddress=info@parallels.com serial:81:FB:06
      • basicConstraints: CA:TRUE

Meta - Aeet.info

Number of occurences: 2
  • Name: Generator
    Content: CMS Made Simple - Copyright (C) 2004-11 Ted Kulp. All rights reserved.
  • Name:
    Content: text/html; charset=utf-8

Server / Hosting

  • IP: 82.159.141.16
  • Latitude: 37.27
  • Longitude: -6.95
  • Country: Spain
  • City: Huelva

Rname

  • ns.aeet.info
  • ns2.dnshostprov.com
  • ns1.dnshostprov.com
  • ns0.dnshostprov.com
  • mail.aeet.info
  • relay.lancomputer.com

Target

  • mjesus.educatur.com

HTTP Header Response

HTTP/1.1 200 OK Cache-Control: no-store, no-cache, must-revalidate,post-check=0, pre-check=0 Pragma: no-cache Content-Length: 0 Content-Type: text/html; charset=utf-8 Expires: Mon, 26 Jul 1997 05:00:00 GMT Last-Modified: Tue, 05 Jul 2016 04:18:51 GMT Server: Microsoft-IIS/7.5 Set-Cookie: CMSSESSID0f1cc5db=2f1c08906d10a84a91d0d01a7b657d2d; path=/ X-Powered-By: ASP.NET X-Powered-By-Plesk: PleskWin Date: Tue, 05 Jul 2016 04:18:51 GMT X-Cache: MISS from s_xt50 X-Cache-Lookup: MISS from s_xt50:80 Via: 1.1 s_xt50 (squid/3.5.14) Connection: keep-alive

DNS

host: aeet.info
  1. class: IN
  2. ttl: 9634
  3. type: A
  4. ip: 82.159.141.16
host: aeet.info
  1. class: IN
  2. ttl: 21600
  3. type: NS
  4. target: ns.aeet.info
host: aeet.info
  1. class: IN
  2. ttl: 21600
  3. type: NS
  4. target: ns2.dnshostprov.com
host: aeet.info
  1. class: IN
  2. ttl: 21600
  3. type: NS
  4. target: ns1.dnshostprov.com
host: aeet.info
  1. class: IN
  2. ttl: 21600
  3. type: NS
  4. target: ns0.dnshostprov.com
host: aeet.info
  1. class: IN
  2. ttl: 21600
  3. type: SOA
  4. mname: ns0.dnshostprov.com
  5. rname: mjesus.educatur.com
  6. serial: 1357727221
  7. refresh: 10800
  8. retry: 3600
  9. expire: 172800
  10. minimum-ttl: 10800
host: aeet.info
  1. class: IN
  2. ttl: 21600
  3. type: MX
  4. pri: 10
  5. target: mail.aeet.info
host: aeet.info
  1. class: IN
  2. ttl: 21600
  3. type: MX
  4. pri: 20
  5. target: relay.lancomputer.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.eet.info, www.aoeet.info, www.oeet.info, www.apeet.info, www.peet.info, www.a9eet.info, www.9eet.info, www.aeet.info, www.eet.info, www.aieet.info, www.ieet.info, www.aueet.info, www.ueet.info, www.aet.info, www.aexet.info, www.axet.info, www.aeset.info, www.aset.info, www.aewet.info, www.awet.info, www.aeret.info, www.aret.info, www.aefet.info, www.afet.info, www.aevet.info, www.avet.info, www.aecet.info, www.acet.info, www.aeqet.info, www.aqet.info, www.aeaet.info, www.aaet.info, www.aeyet.info, www.ayet.info, www.aet.info, www.aeext.info, www.aext.info, www.aeest.info, www.aest.info, www.aeewt.info, www.aewt.info, www.aeert.info, www.aert.info, www.aeeft.info, www.aeft.info, www.aeevt.info, www.aevt.info, www.aeect.info, www.aect.info, www.aeeqt.info, www.aeqt.info, www.aeeat.info, www.aeat.info, www.aeeyt.info, www.aeyt.info, www.aee.info, www.aeetq.info, www.aeeq.info, www.aeeta.info, www.aeea.info, www.aeet .info, www.aee .info, www.aeetw.info, www.aeew.info, www.aeete.info, www.aeee.info, www.aeetz.info, www.aeez.info, www.aeetx.info, www.aeex.info, www.aeetc.info, www.aeec.info,

Other websites we recently analyzed

  1. Henning80.de
    Germany - 31.47.241.100
    Server software: Apache
    Technology: CSS, Html, Javascript, jQuery UI, Php
    Number of Javascript: 4
    Number of meta tags: 1
  2. usvos.info
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  3. pleasegivewillyapleasemaamsir.org
    Scottsdale (United States) - 50.63.202.54
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  4. Marlboro Florists - Flowers in Marlboro NY - Love's Flowers
    Order flowers online with Same Day Delivery from Love's Flowers. Fresh flowers and hand delivered right to your door. Experience the Teleflora difference!
    Oklahoma City (United States) - 65.198.163.112
    Server software:
    Technology: CSS, Html, Iframe, Javascript, jQuery Cycle, Php, Maxymiser, Facebook Like box
    Number of Javascript: 10
    Number of meta tags: 1
  5. conjuegamos.com
    Switzerland - 141.8.224.247
    Server software: nginx/1.9.9
    Technology: Html
  6. Lisa Blue Rogers
    Lisa Rogers Studio site contains artwork done by Lisa Rogers
    New York (United States) - 198.185.159.144
    Server software:
    Technology: CSS, Html, Javascript, Lightbox, Php, SVG, Squarespace
    Number of Javascript: 3
    Number of meta tags: 6
  7. psychotherapie.co
    Austria - 86.59.107.231
    Server software: squid/3.5.9
    Technology: Html
  8. Congratulations! Welcome to your new Web Site!
    Montréal (Canada) - 192.99.170.10
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  9. GT Wheels Inc.
    Provo (United States) - 50.87.249.62
    Server software: nginx/1.10.1
    Technology: Carousel, CSS, Fancybox, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 22
    Number of meta tags: 3
  10. 50groenesmoothierecepten.nl
    Provo (United States) - 50.87.144.123
    Server software: nginx/1.10.1
    Technology: Html
    Number of meta tags: 2

Check Other Websites